The Problem Of Global Warming - 1718 Words

Analyse the problem of global warming and suggest possible solution With the rising global temperatures, the global warming has become more and more popular. In fact, it is a natural phenomenon, which has developed in recent decades due to human?s activities, such as burning of fossil fuels and deforestation. These actions will produce large amounts of greenhouse gas, which would cause the Earth s temperature go up so that the climate will change. More importantly, the Global warming melt all the world s glaciers and permafrost so that the level of the sea will go up. As a result, human and natural ecosystems will suffer from great harm. There are many reasons why the global climate is changing. Among those, there are two main reasons, the surge of population and serious environmental pollution. Unfortunately, those two reasons are caused by our human?s activities. This essay will analyse the cause of this problem and list two solutions on global warming. The first one is to promote clean energy and reduce the use of fossil fuels. The second one is to call for people to eat meat. The most important factor the climate change is the growing population. Proportional to the increase in human population and resource consumption, and faster population growth and large population size, the more emissions will impact on the climate. The relationship between population and climate change is complex, not as simply as reducing the performance of the total population change or theShow MoreRelatedGlobal Warming Is A Problem Essay1527 Words   |  7 PagesAbstract Global warming is a dilemma; it is a debatable issue between a fact and a theory, between approval and disapproval and between having advantages and disadvantages. Endless questions that have indefinite answers arise to a man’s mind when just tackling the idea of the global warming. Many people do not take in consideration the environmental issues, their main interests lie behind thinking about their personal lives and needs. Only few who think about the environment they‘re living in. IsRead MoreThe Problem Of Global Warming1131 Words   |  5 PagesOne of the biggest problems facing in today s world is global warming. It is affecting the earth from climate changes, storms becoming worse over time creating damage to peoples homes, species dying because they can’t adapt rapidly to the changes, animal s population is shrinking and new diseases being created. Thankfully through time we have developed new technology to reduce the effect of global warming. However since we have dealt with global warming for so long for many years, we have doubleRead MoreThe Problem Of Global Warming1228 Words   |  5 PagesWhat is a Social Problem? A social issue is defined as an area of conflict in a social setting that influences different people and is often out of reach of the control of an individual or local geographical authority (Weart 73). Some social problems, however, are not perceived universally as such, resulting in a difference in opinion between different groups. Other social issues are universally recognized as justifiable and, therefore, are addressed by everyone. Global warming is a social issueRead MoreGlobal Warming Is A Problem1381 Words   |  6 PagesWhat is global warming? Global warming is the polar bears and penguins fighting for their lives because their home is melting. Global warming is seventy-degree weather in the middle of February. Global warming is the rapid increase in tropical storms. Global warming is the California drought. Global warming is the harmful wildfires occurring in our forests (NRDC). Many people, mostly politicians, believe that global warming is a problem that doesn’t exist. Global warming is a real issue that we cannotRead MoreThe Problem Of Global Warming1311 Words   |  6 Pagesknow is inhabitable is now being destroyed by man. As humanity has revolutionized we have created many problems along the way. The main problem we are facing right now is called global warming. We have damaged many ecosystems trying to better ourselves, and we have not yet once thought about the damage we are inflicting on our mother earth. We are already beginning to see the effects of global warming. It will make little changes that will have a huge impact, and devastate many ecosystems and everythingRead MoreThe Problem Of Global Warming1430 Words   |  6 PagesGlobal Warming in the United Stated Global warming is no longer just a prediction it is actually happening. It is undisputed that the average temperature at the surface of Earth has increased over the past century by 1 degree Fahrenheit, with both the air and the oceans warming. Since 1880, when people in many locations first began to keep temperature records, the 25 warmest years have all occurred within the last 28 years. The problem is that if we keep on hurting our own environment and ecosystemsRead MoreThe Problem Of Global Warming1443 Words   |  6 Pagesstruggle such as the Syrian war. One reason why Syrians are engaged in a war is that they are experiencing extreme heat and drought which causes them to be more rebellious and aggressive. The underlying cause of these trouble can be due to global warming. Global warming occurs when carbon dioxide and other greenhouse gases trap heat in Earth’s atmosphere because some of the sun’s ray cannot escape. It is a worldwide phenomenon that impacts each a nd every one of us because it cause irregular climate patternsRead MoreThe Problem Of Global Warming1088 Words   |  5 Pagesthe story in the movie The Age of Stupid, in which a man lives in the devastated future world of 2055. The man looks back to today’s date and asks himself why we did not stop the climate change when we had the chance. However, today global warming is out of control, global temperatures are steadily rising. â€Å"The primary cause, a consensus of scientists has said, is the rising emissions of greenhouse gases like carbon dioxide and methane† (Stone, 2013). The CO2 stays in the atmosphere for 50 to 100 yearsRead MoreGlobal Warming Is A Problem1654 Words   |  7 Pagesthis reason is global warming. Global warming is a problem that some people choose to ignore. They claim it does not exist. Global warming is real. It is time for people to stop ignoring it and start searching for a solution. Although many people do not believe in global warming, blaming the climate change on the sun, global warming is a serious danger to the Earth because it could have serious effects on the plant and animal populations. To fully grasp the effects of global warming, one must firstRead MoreGlobal Warming Is A Global Problem1418 Words   |  6 PagesThe reason why, I decided to focus on global warming is because it doesn’t just affect one person it affects everyone as a national crisis. Numerous individuals don’t believe in global warming, but to scientist this is a big dilemma. In the article, â€Å"closer looks at climate change, it’s specified that these issues are not new, they have been around forever† (Schmidt, 2010). â€Å"In the article the real case against activist global warming, has gotten the response of the president of the United States†

Stereotypes Exist Because They Are Grounded in Truth Free Essays

Stereotypes Exist Because They Are Grounded In Truth Has anyone ever said that ‘unicorns exist in real life and that they have seen them’? Or that they ‘felt hot while it was snowing’? Or that ‘cats can bark like dogs’? Clearly there is no truth to these statements. This is simply because unicorns do not exist in real life, you cannot feel hot if it is snowing, and that cats simply cannot bark like dogs. Life cannot exist without water, what goes up must come down, and similarly any statement which is accepted by thousands of other people must have some hint of truth to it. We will write a custom essay sample on Stereotypes Exist Because They Are Grounded in Truth or any similar topic only for you Order Now As Kanazawa says â€Å"Many stereotypes are empirical generalizations with a statistical basis and thus on average tends to be true. If they are not true, they would not be stereotypes† (â€Å"The Scientific Fundamentalist†). Although some people argue that stereotypes are just over generalizations, and that people use them to perceive the stereotyped groups’ characteristics, most stereotypes are true as what is generally accepted in society must be somehow grounded in reality. Moreover, many stereotypes have been proven by science, and conducted psychological studies such as stereotype threat. People who believe that stereotypes are false, argue that stereotypes are just over generalizations. They argue that stereotypes represent just a small minority of the group being stereotyped against. They give the example of the stereotype that â€Å"all blondes are dumb. † And state that while some blondes may be dumb, not all of them are, in fact many are quite smart. They say that one’s hair color has no effect on ones intellectual capability. While this may be true for some of the stereotypes, many of the stereotypes actually represent the majority of the group being stereotyped. For example the stereotype that ‘college educated people have bigger incomes than those who have only completed high school’ is a valid assessment. Yes, this might be true in some cases. But as proven by the â€Å"The College Payoff† a report published by the Georgetown University, while there might be a small handful of people who are only high school educated and who earn more than many of the college educated people, still most of the college educated people have a higher salary then high school educated people (Carnevale, Rose, and cheah â€Å"the college payoff†). So although there may be some stereotypes that are false or depict over generalization, most of the stereotypes in fact are based on assessments and actions of the majority of the group being stereotyped. Furthermore, people who argue that stereotypes are false state that people continue to cling on to stereotypes because it is quick and comfortable. It allows people to think they are gathering information about other people, without having to stop and actually spend time understanding the person or groups true personality. They claim that because of this many of the people or groups are misunderstood. However, what these people do not realize is that many of these stereotypes quite rightly show some of the traits of the group or individual being stereotyped. An example is the stereotype, ‘Jews are adept money handlers’. The fact is that this stereotype is true to quite a great extent. According to ‘The Weakonomics’, â€Å"you see an overwhelming representation of Jewish people within industries that revolve around the exchange of money†¦ Not only have they dominated finance†¦ † (â€Å"Why Do We Associate Jews with Money? †). While some of the Jews are either lawyers or doctors, most of them are in a field related to finance such as banking. In fact most of the people in top positions related to finance are Jews like the treasurer of the United States, and the Secretary of the Treasury. In fact most of the people running the American Treasury happen to be Jewish. Another example is the stereotype that Asians are smart and studious. Some people say Asians are smart because they are taught differently in their home country, others claim that Asians are smart because they are very studious, and still others say that Asians are studious because they feel academically at a loss when they come to foreign places to study and to compensate study harder. Whatever may be the reason, the truth remains that Asians are smarter and more studious than most of people. Thus, while some stereotypes might contain some discrepancies, most of the stereotypes show the truth about the group being stereotyped. Stereotypes do not just come out of thin air; they were based on actual observations of people or their actions. An event must have occurred to have that formed these stereotypes. For example according to Meltzoff, Cvencek and Greenwald, the stereotype that boys are better in math then girls forms almost as early as second grade when boys start to associate with math and start doing better than girls in the subject (766-799). In fact all of the stereotypes have evolved from an origin. The stereotype that ‘blacks are good at sports’ came about because in almost every sport there is a black athlete who dominates the others. As sports sociologist Ben Carrington points out, at the beginning of the 20th century, whites were considered to be superior to blacks intellectually, aesthetically and even physically. However by the 1930s, this logic began to change as blacks started to be viewed as physically superior to whites in matters related to sports (Interview of Carrington, University of Texas). Another example is the stereotype that ‘Italian men are very romantic’. This stereotype exists because of the Italians’ constant flirting with girls and their traditions which involve kissing a girl on her hand as a greeting. As Megalio says, Italian men â€Å"tell you that you’re beautiful and really mean it, feed you to show their affection, cry rarely but genuinely and work hard in honor of the woman they love† (â€Å"Why Women Can’t Get Enough of Them†). Another example is the stereotype that ‘Italian men have an unhealthy obsession with their mothers. ‘ According to Pike and Allen; married or not, one in three Italian men sees his mother every day (The Guardian). Thus, stereotypes are formed based on history and statistics, but in order to survive they must be regularly reinforced. While there might be some stereotypes that do not apply to the majority of the group being stereotyped against, or are exaggerated truths, many of the stereotypes have in fact been proven by science. For example, according to Susan, quite a lot of gender stereotypes have been proven to be true by science (â€Å"Gender Stereotypes That Science Says Are True†). These stereotypes include ‘Women Love to Talk’ and ‘men are comparatively color blind’. As per the stereotype women love to talk, Susan talks about how the areas of the brain responsible for language are larger in women than men, and how the female brain processes language in both hemispheres of the brain (â€Å"Gender Stereotypes That Science Says Are True†). Moreover, regarding the stereotype ‘men are comparatively color blind’, Susan talks about how the gene for seeing red is carried by the X-chromosome, and men have one X-chromosome while women have two, which puts men at a disadvantage at seeing the color spectrum (â€Å"Gender Stereotypes That Science Says Are True†). Another example is the stereotype that black people can’t swim. In the first of its kind survey by USA swimming, it found that nearly 60% of black children have not been given aquatic training. (Quoted. in msnbc). Therefore, as we can see from the examples given, many stereotypes have actually been proven by science to be true and are hence more than just exaggerated truths. Lastly, another way in which stereotypes are true is the fact that they actually reinforce stereotypical behavior. This phenomenon is known as stereotype threat, whereby an individual is constantly exposed to negative images of his/her racial or ethnic group, this person starts to accept the same social and personal characteristics of these images as self characteristic. In fact psychologists, Steve and Aronson, conducted several experiments in which they proved that the phenomenon of stereotype threat does exist. When female participants were primed before a test of not being as smart as their male counterparts, their scores were significantly lower as compared to when the women were led to believe the tests did not reflect these stereotypes(â€Å"A threat in the air† 613-629). The same experiment was run again using African-Americans and Americans with the same results (â€Å"Stereotype threat and the intellectual test performance† 797-811). Thus proving that the person acts like the way he/she was stereotyped to be. Stereotypes might be flattering or insulting. They might have positive effects or negative ones. But at the end of the day the fact remains that most of the stereotypes are true because they are grounded in actual observations of people, they have been proven by science, and because of the concept of stereotype threat. As David Cronenberg says â€Å"All stereotypes turn out to be true. This is a horrifying thing about life. All those things you fought against as a youth: you begin to realize they’re stereotypes because they’re true. † Therefore, just as smoke cannot exist without fire, stereotypes cannot exist without truth. Works Cited Kanazawa, Satoshi. â€Å"The Scientific Fundamentalist. † Psychology Today. 24 April 2008. Web. 12th March 2012 ;http://www. psychologytoday. com/blog/the-scientific-fundamentalist/200804/all-stereotypes-are-true-except-i-what-are-stereotypes;. Carnevale, Anthony P.. Rose, Stephen J.. Cheah, Ban. â€Å"The College Payoff†. Georgetown University Center for Education and the Workforce. 5th August 2011. Print. ; http://cew. georgetown. edu/collegepayoff/; â€Å"Why Do We Associate Jews With Money? † The Weakonomics. 27th July 2009. Web. 12th march 2012 ; http://weakonomics. om/2009/07/27/why-do-we-associate-jews-with-money/ ; Cvencek, D. , Meltzoff, A. N. and Greenwald, A. G. (2011), â€Å"Math–Gender Stereotypes in Elementary School Children Child Development†, 82: 766–779. ;http://onlinelibrary. wiley. com/doi/10. 1111/j. 1467-8624. 2010. 01529. x/abstract; Blacks, Sports and Lingering Racial Stereotypes: A Q;A with Sports Sociolog ist Ben Carrington. Interview by University of Texas. 25th August 2010. Web. 12th march 2012. ;http://www. utexas. edu/opa/blogs/shelflife/2010/08/25/blacks-sports-and-lingering-racial-stereotypes-a-qa-with-sports-sociologist-ben-carrington/; Meglio, Francesca Di, â€Å"Italian Men: Why Women Can’t Get Enough of Them†?. Our Paesani. Web. 12th march 2012. http://italiansrus. com/articles/ourpaesani/italianmen. htm Pike, Rebecca; Allen, Carmel. â€Å"Mamma mia†. The Guardian. 14th May 2002. Web. 12th March 2012. http://www. guardian. co. uk/world/2002/may/14/gender. uk H. Susan. â€Å"6 Absurd Gender Stereotypes (That Science Says Are True)†. 10th May 2010. Web. 12th March 2012. http://www. cracked. com/article_18529_6-absurd-gender-stereotypes-that-science-says-are-true_p2. html â€Å"Nearly 60 percent of black children can’t swim†. Associated Press. Msnbc. 5th January 2008. Web. March 12th 2012. ;http://www. msnbc. msn. com/id/24411271/ns/health-childrens_health/t/nearly-percent-black-children-cant-swim/#. T2CsyBHxrNl; Steele, C. M. â€Å"A threat in the air: How stereotypes shape intellectual identity and performance†. American Psychologist. 1997. Print. 52, 613-629. Steele, C. M. , and Aronson, J. â€Å"Stereotype threat and the intellectual test performance of African-Americans†. Journal of Personality and Social Psychology. 1995. Print. 69, 797-811. Cronenberg, David. Brainy Quote. Web. How to cite Stereotypes Exist Because They Are Grounded in Truth, Essay examples

Accounting Information System Tools

Question: Write about theAccounting Information System Tools. Answer: Accounting information systems (AIS) are tool integrated in the information systems designed to help in the control and management of the organizations especially in the financial sector. The tool are necessary in tracking and monitoring the organization financial plans and budget. AIS tools are the components which are put together to collect raw data and process them into financial data for the shareholders to understand the progress of the company. The raw data is the information gathered like reports and the current trend of the company. For an organization to succeed they must have Accounting information tool for the strategic planning. Due to the changing economy and environment the AIS tool are required to leverage a strong flexible culture for success. Investing in the tools they will increase the performance of the company, reduce financial obstacles and help the company access the capital market. The AIS design tool combines the controls, methodologies and accounting techni ques with the information technology to track transactions, financial statements, provide an internal and external reporting data and analyses the trending factors in the environment. These will help the organization to increase its performance (Chuck, 2009). Data analysis are mainly done by the auditors who need to know more about their rivals and clients. The data analysis tool have helped the organizations gain deeper knowledge about their clientele. The data analytic have advanced in the internal auditing than the external auditing. The organization use continuous monitoring and auditing of data to identify risk and any irregularities which act as a form of internal control (Kuiper, 2012). The data analytics could be used to test the whole set of data instead of the samples in the external financial statement. The Data mining and analysis also helps in identifying risk or carrying out risk assessment through identification of irregularities and trends of the current environment. The tools can also be used to compare the company performance, data and important information that the auditors need to investigate. The tool are also used in providing audit evidence by providing the comprehensive analysis of the organization general ledger systems. Data mining is the process of analyzing raw data into a summarized and more perspective based information Michell (2009).The information is useful in increasing revenue and reducing costs. Data mining is an Account information system tool used in extracting and analyzing data. The software provide the users to interpret information from different Angles and dimensions. The information is then classified, categorized and then summarized. The importance of data mining is to provide patterns and relationships of the raw material in the databases (Clipping, 2012). Data mining has been used by large corporation to scan the volumes of data and analyses the market. The process is done though the mining softwares in computers. The revolution of technology in computers in terms of increased storages, processing power accurate softwares has made data mining easy in terms of accuracy and fats results. The use of the softwares has reduced cost in production and labor. The extracted can also be used to identify the buying habits and patterns of consumers .The Information can be used by companies with widespread retail store to control and manage the inventory as well as identify new market gaps and opportunities in the market. The data mining tool can be useful in live recording of games. They can be used to analyze and monitor the movement of the players to help the referees to manage the game fairly. They can also help the coaches to formulate new strategies and game plans. Process of Data Mining and the Benefits Raw data is data in form of numbers, texts and facts that the computer processes. The organizations accumulate volumes of unprocessed data in different format and in different databases. The type of raw data in an organization include the Operational and transactional data, nonoperational data and Meta data. The operation data are the data from internal activities of the company such as the cost, inventory, sales and payroll. The non-operation data are the record of the industry sales, economic analysis and research. The Meta data is the dictionary or the database of all the other data. It also store information like logical database and designs. The main work of the data mining tool is to extracting the important information for each department and arranging this information for records. The data analyses software then evaluates, processes and interpret the data into information (Hirsch, 2011). The data mining tools are used by cooperation with a strong focus to their consumers in terms of communication, finance and accounting, retail and marketing. The tool help the company to balance between the internal and external factors .The internal factor here been the labor skills, prices and product promotion while the external factors include; customer behavior patterns, competition from existing and upcoming companies and economic forecast and future trends. The tool help the company to measure the impact on profits, sales and customers satisfaction. The software helps the company to conclude the finding and summarize the information outcome for the shareholders understand (Goodman, 2010). The tools can be used to send customized promotions for the consumers based on the individual purchase history. The data can be mined from the point of sales records of the customers who purchased the items. The data can also be mined from the warranty records and the customers feedback. The information could be used by the organization to develop custom products and promotion to appeal certain customer or they could use them to target certain group or class of customer in the market. The extracted can also be used to identify the buying habits and patterns of consumers .The Information can be used by companies with widespread retail store to control and manage the inventory as well as identify new market gaps and opportunities in the market. The data mining tool can be useful in live recording of games. They can be used to analyze and monitor the movement of the players to help the referees to manage the game fairly. They can also help the coaches to formulate new strategies and game plans. The data mining and analyses software are used in football matches to replay live goals and display it in multiple screen for the fan to watch their favorite moment. The gathering, storing and using the customers information can cause a lot of unethical issue to the company. Most of the data collected from the customer is at times done without their knowledge. An example is when a customer shops in the supermarket an pays for the good using the point of sale system. The customer leaves some information like the product they bought and the amount spent. The company can use that information to their advantage by knowing their customer purchasing patterns. Acquiring the information without the consent of the customer is unethical .The company should inform the customer but most companies cannot do that. When the customer comment or purchase an item online the company can track their location. The information is important to the company but at times the if the information falls into the wrong hand the customer can end up suffering. The information can be important to the company by for studying their market share but it can lead to problem to the customer if the information gets to the wrong hands. Most of the suppliers use cookies in their website to collect information from the customer without their consent. Marketers collect big data from the consumers through the internet. The marketers can ask the users questions directly through Email, or they can obtain information from the customer's visit on their website. The buyers are requested to fill their personal information on the site. The information can be used by the company marketers to evaluate the consumer needs and provide a solution to the consumers marketing goals. Some of this information provided can be personal and can be used to hurt the clients. The consumer can provide his or her location and if this information fell into the wrong hands can be used to track the users and maybe steal their property. Some markers use marketing tool on the websites such cookies to collect information from the consumers without their knowledge. The consumer can be innocently shopping online while the marketers can be collecting personal information and habits from the consumers (Kurtz, 2012). The marketers can use the information to stay ahead of their competitors by understanding the consumer and customizing their product to suit the consumer. Theses information can be used to expose the bad habits of consumers whereby maybe the consumer visit some private website or get information on the net which should stay private. The marketers can use this information to blackmail the consumer (Gerber, 2015). The marketer can use this information to blackmail the consumer in exchange for something. Information provided by the consumer should be utilized for market analysis only. Marketers should use the information they get to give the consumer a better marketing experience, while they observe their work ethics and respect the consumer privacy References Kuiper, S., Clippinger, D. A. (2012). Contemporary data mining report writing. Mason, Ohio, South-Western. Goodman, M. B., Hirsch, P. B. (2010). Data analysis and mining: strategic adaptation for global practice. New York, Peter Lang. Lehman, C. M., Dufrene, D. D. (2009). Data mining. Instructor's manual. Cincinnati, Ohio, South-Western. Noor Al-Deen, H. S., Hendricks, J. A. (2012). Data mining: usage and impact. Lanham, Md, Lexington Books. Guffey, M. E. (2017). Business Communication: data process product. Cengage Learning. Wales, T. (2014). Business school libraries in the 21st century. Lewis, P. S. (2007). Management: challenges for tomorrow's technology Mason, OH, Thomson/South-Western. Gambetti, R. (2012). Data mining tools of analysis. Palgrave Macmillan. Guffey, M. E., Almonte, R. (2010). Essentials of data mining. Guffey, M. E. (2017). Business Communication: data process product mining. , CENGAGE LEARNING. Goodman, M. B., Hirsch, P. B. (2010). Data mining: strategic adaptation for global practice. New York, Peter Lang.

Descartes discourse on method Essay Example For Students

Descartes discourse on method Essay Understanding Descartes Method of DoubtClear your mind, if you will, of everything you have ever seen or known to be true. To begin understanding Rene Descartes method of doubt, you need to suspend all prejudice and prior judgments and start with a clean slate for the purpose of discovering some ultimate truth on which to base all thought. (Kolak, Pg.225). Discouraged with much skepticism from his own beliefs, Descartes was embarrassed of his own ignorance. He set out to try and accomplish the task of finding an absolute truth in which he would base his beliefs. Placing upon himself a task to find an axiom or absolute truth to base all thought, he ventured as a youth in travel to collect a variety in experiences to derive some profit in which he would be benefited. (Kolak, Pg.225). When analyzing the method of doubt you must take complex conceptions into their constituents until the irreducible elements are simple, clear, and distinct ideas, and show that all such basic ideas can be derived from, or can depend upon, the primary consciousness of a being that it thinks. (Durant, Pg.639). Two types of knowingFirst, understanding that there are conceptually two types of knowledge or knowing aposteriori, and apriori, you can further understand where Descartes is coming from with his representations of his elucidations. Knowledge that is based solely on the sense and reasoning that comes through the senses is understood as aposteriori, and its foil a priori is understanding through reasoning. At this point, Descartes has already discarded aposteriori knowledge on the basis that his senses are deceiving and it is not a credible way to base ones beliefs. (Descartes, Pg.19). On the other end of the spectrum, apriori knowledge ,which is an understanding based on reasoning, is a more efficient way of explaining the method of doubt presented by Descartes. Method of Doubt Step OneOn the journey to find truth to base all thought upon, Descartes explains his first step in doi ng so. Never accept anything for true which I did not clearly know to be such; that is to say, carefully to avoid precipitancy and prejudice, and to comprise nothing more in my judgment than what was presented to my mind so clearly and distinctly as to exclude all ground of doubt.(Kolak, Pg.228). Assuming that everything you see is fictitious, Descartes believed he had no senses at all; body, shape, extension, motion, and place are unreal.(Weissman, Pg.23). Our senses have failed us all at one point or another in our lives, so why use the senses as a base for thought? The most famous quote and philosophy by Descartes in history ever, Je pense, donc je suis, cogito ergo sum (Durant, Pg.639). I think, therefore I am was the first step towards a basis to understand truth, and leaning away from truth through the senses. Method of Doubt Step TwoThe second argument that Descartes defends is another question posed towards the senses. How can we take anything as real if our dreams cannot be deciphered from reality? In dreams there lies deception by similar illusions found in reality. So we must make sense that there are no certain marks by which the state of waking can ever be distinguished from sleep. (Kolak, Pg.239). Descartes recollects sitting next to the fire and feeling the warmth and the realness that related to it, but we still feel the warmth of the fire outside the dream. Having already a preconceived notion that there exists a supreme power of God, Descartes says, I cannot avoid conceding that, at least if he wishes, it is easy for him to make err even about things that I think I see most clearly with my minds eye. (Weissman, Pg.32). He basically states in his meditations that if there is a God, and he is perceived as good, why would he deceive our thoughts? This brings up the evil deceiver argument. If we can only know that our existence is real, who is to say that there is not an outside force that makes of the rest of our reality that we supposedly live? If our dreams are just distorted pieces of our reality and our reality is merely a show put on by the evil deceiver, we know for certain we cannot base our beliefs on what we see and the tools unto which we use to perceive it; i.e. extension, hands, and eyes. .ufe620daa1c5cf7a7c0fd115c5fa38cab , .ufe620daa1c5cf7a7c0fd115c5fa38cab .postImageUrl , .ufe620daa1c5cf7a7c0fd115c5fa38cab .centered-text-area { min-height: 80px; position: relative; } .ufe620daa1c5cf7a7c0fd115c5fa38cab , .ufe620daa1c5cf7a7c0fd115c5fa38cab:hover , .ufe620daa1c5cf7a7c0fd115c5fa38cab:visited , .ufe620daa1c5cf7a7c0fd115c5fa38cab:active { border:0!important; } .ufe620daa1c5cf7a7c0fd115c5fa38cab .clearfix:after { content: ""; display: table; clear: both; } .ufe620daa1c5cf7a7c0fd115c5fa38cab { display: block; transition: background-color 250ms; webkit-transition: background-color 250ms; width: 100%; opacity: 1; transition: opacity 250ms; webkit-transition: opacity 250ms; background-color: #95A5A6; } .ufe620daa1c5cf7a7c0fd115c5fa38cab:active , .ufe620daa1c5cf7a7c0fd115c5fa38cab:hover { opacity: 1; transition: opacity 250ms; webkit-transition: opacity 250ms; background-color: #2C3E50; } .ufe620daa1c5cf7a7c0fd115c5fa38cab .centered-text-area { width: 100%; position: relative ; } .ufe620daa1c5cf7a7c0fd115c5fa38cab .ctaText { border-bottom: 0 solid #fff; color: #2980B9; font-size: 16px; font-weight: bold; margin: 0; padding: 0; text-decoration: underline; } .ufe620daa1c5cf7a7c0fd115c5fa38cab .postTitle { color: #FFFFFF; font-size: 16px; font-weight: 600; margin: 0; padding: 0; width: 100%; } .ufe620daa1c5cf7a7c0fd115c5fa38cab .ctaButton { background-color: #7F8C8D!important; color: #2980B9; border: none; border-radius: 3px; box-shadow: none; font-size: 14px; font-weight: bold; line-height: 26px; moz-border-radius: 3px; text-align: center; text-decoration: none; text-shadow: none; width: 80px; min-height: 80px; background: url(https://artscolumbia.org/wp-content/plugins/intelly-related-posts/assets/images/simple-arrow.png)no-repeat; position: absolute; right: 0; top: 0; } .ufe620daa1c5cf7a7c0fd115c5fa38cab:hover .ctaButton { background-color: #34495E!important; } .ufe620daa1c5cf7a7c0fd115c5fa38cab .centered-text { display: table; height: 80px; padding-left : 18px; top: 0; } .ufe620daa1c5cf7a7c0fd115c5fa38cab .ufe620daa1c5cf7a7c0fd115c5fa38cab-content { display: table-cell; margin: 0; padding: 0; padding-right: 108px; position: relative; vertical-align: middle; width: 100%; } .ufe620daa1c5cf7a7c0fd115c5fa38cab:after { content: ""; display: block; clear: both; } READ: Polymers EssayConclusionDescartes makes it clear that we cannot be certain of anything. The method of doubt brings us to understand this better by giving a set of guidelines to follow to systematically understand and get closer to some kind of truth. By trying to find some truth to base all thoughts on, Descartes tried to find an absolute truth by coming to the realization that nothing he believed was of any truth. Although not finding much truth in his journeys, he found a systematic way to come closer to finding truth. Descartes was presented with a problem of not knowing anything, and by creating the method of doubt he came closer to finding the truth. Works Cited PageD urant, Will ; Ariel. (1961). The Story Of Civilization. The Age Of Reason Begins. New York: Simon ; Schuster. Weissman, David. (ED.). (1996). Rethinking The Western Tradition. New York: Vail-Ballou Press. Descartes, Rene. (1998). Meditations And Other Metaphysical Writings. New York: Penguin Putnam Inc. Kolak, Daniel. (2001). Lovers Of Wisdom: An introduction to philosophy with integrated readings. (Second Ed.).

Sample Dental Hygiene Application Essay For Your Employer

Sample Dental Hygiene Application Essay For Your EmployerA sample dental hygiene application essay for your employer should focus on a job requirement of the employer. It would have to be short and to the point. It should also contain vital information of which the employer requires in order to be able to function efficiently and in a way that suits them.A typical hygiene application essay for your employer is to state a special interest about yourself. It may be as simple as what your dream career would be. However, the more detail you go into, the better. This is because employers want to see that you are a person who can be of use to them and the position requires a certain level of professionalism, if you can provide it.It is always important to present information that is factual and that is not biased with respect to the applicants being considered. The essay should be clear, concise and interesting.Now this is a problem because a lot of people write an essay and forget all the ir needs and requirements. These particular essays are usually kept in a very small office. So, it's a good idea to present your ideas in as much detail as possible.Employers need to understand that applying for a job and then writing an essay is very different from applying for the job. They expect it to be concise and to the point.What you would want to include in your sample dental hygiene application essay for your employer would be a description of a past day's activities. You could ask if there are any experiences that can match those.It is imperative that your essay has a goal in mind. If it is just to write about your love of pets, it will not be the best one to use in writing the resume.

Operations Strategies adopted by Schultz as CEO of Starbucks

Executive Summary Quality management in terms of services, products and operations management is a critical aspect in business sustainability and development. This paper analyzes the experience of Starbucks in order to emphasize the notions of control and management as well as competent operations.Advertising We will write a custom essay sample on Operations Strategies adopted by Schultz as CEO of Starbucks specifically for you for only $16.05 $11/page Learn More The most eminent practice of Howard Schultz was his consideration of all needs and desires of customers by introducing additional quality products and coffee varieties into the menu. Besides, Schultz concentrated on employee training. Further, Schultz reviewed the supply chain of the Company in order to cut costs and enhance efficiency. The paper concludes that the operations strategies adopted by Schultz brought numerous changes to the Company. Before the crises between the years 2006 and 2008 Starbucks offered its customers coffee with the grand experience (Burks 2009). The Company had knowledgeable, sociable baristas that provided coffee in a trendy environment where people could socialize, unwind, operate their laptops, etc (Michelli 2007). Nevertheless, the situation changed when the USA experienced a financial crisis, thus, forcing citizens to reduce the amount of money that they usually spent on luxuries. Consequently, Starbucks experienced a lessened demand for its costly coffee drinks as well as a striking decline in the value of its stock. Howard Schultz reappeared as the CEO of Starbucks in 2008 at the time when both the corporation and the nation were experiencing a crisis. The annual sales of the Company experienced a percentage decline of 467% between 2006 and 2008 (Burks 2009). Schultz attributed this fall to rapid expansion, which compromised the quality of its products and services. The quest for growth had obstructed the Company’s core business of offering comfortable places for people to relax while taking sumptuous cups of coffee. Hence, Schultz realized that quality management was essential in restoring Starbucks to its initial upward course. After Schultz took his position as the Company’s CEO, the first thing that he accomplished was to shut down 600 coffee shops that performed poorly at that time. Besides, he visited many Starbucks’ outlets in order to establish the needs and desires of customers. Schultz solicited for customers’ views through direct contact.Advertising Looking for essay on business economics? Let's see if we can help you! Get your first paper with 15% OFF Learn More Schultz then used customers’ requirements to design quality and reliable drinks as requested by customers. Schultz considered all needs and desires of customers by introducing additional quality products and coffee varieties into the menu. In addition, Schultz focused on meeting customers’ n eeds for quality and value through aligning the prices of its commodities to its Company strategy. Since its foundation, Starbucks maintained high price on its products because of supposed premium image that became associated with its brand. However, after Schultz reoccupied his seat as the Company’s CEO, Starbucks began offering a bottomless 8 oz cup of coffee at $1 with infinite top ups which cost about 50 cents less than all other products of the Company. Moreover, Starbucks has adopted value strategies that stress more on economical and cheaper coffee products, though initially they are supposed to be high-priced. Another perspective that Schultz concentrated on was employee training so as to meet the needs of customers. For instance, Schultz closed all Starbucks’ outlets in America for three hours in order to train employees on how to make the ideal espresso drink. Schultz recognized the value of equipping employees with competent skills that would enable them to make products that meet customers’ standards. Thus, Schultz spent more time on training employees and less time on advertising, which was every beneficial. He recognized that Starbucks‘s employees were the most appropriate people to convey the passion and knowledge to customers. Further, Schultz focused on intensifying profits in existing stores through enhancing technology investments and operational efficiencies. By doing so, Schultz recognized that the improvements of the quality of customer service in terms of factors such as time and resources are due to use of technology. For instance, the Company proclaimed its focus for entertainment business on digital strategy in 2008 (Paryani 2011). Since 2008, when Schultz returned as the Company’s CEO, Starbucks services extended from coffee and pastries to smoothies and wraps, which enabled the Company to maintain competition and meet all consumer needs. In addition, Schultz launched new products, for instance Starb ucks VIAâ„ ¢ Ready Brew Coffee, food offerings with no artificial flavors, corn syrup or dyes.Advertising We will write a custom essay sample on Operations Strategies adopted by Schultz as CEO of Starbucks specifically for you for only $16.05 $11/page Learn More By doing so, the Company was able to grow its consumer products, and thus, exploiting their brand responsiveness and setting up themselves as the most acknowledged and appreciated brand in the world to their intended market. Schultz, also, made strategic investments in chief strategies through concentrating on controlled, global store extension in main markets. He identified some key zones that could be fit for expansion, while closing outlets that did not seem necessary. In 2008, Schultz took time to review the supply chain of the Company, in order to establish irregularities that cost the Company too much. The assessment revealed that the supply chain had expanded rapidly through outsourcin g. However, outsourcing had as well caused cost inflation (Jacobs Chase 2011). Reacting to those results, Schultz structured a supply transformation plan with three phases. The organization of Starbucks’ supply chain, which was the first step in the plan, began towards the end of 2008. This entailed taking a compound arrangement and splitting it so that each work became grouped under the four central functions of supply chain including sourcing, planning, manufacturing and distribution (Boyer Verma 2010; Stevenson, 2009). For example, all persons who participated in planning and introduction of new products became categorized in planning. Similarly, all workers involved in customer service and delivery became consigned to the delivery category. The second part of the plan was to cut down costs and enhance efficiency (Pearce Robinson 2009). To complete this step, the sourcing group set up strategies that would establish the cost drivers that were making prices go up (Russel l Taylor 2011). In addition, the manufacturing group came up with a competent model for supplying coffee beans to its manufacturing plants as part of the plan with the objective of making productions in areas where the commodity got sold. The merits of this strategy were seen immediately, since regionalizing its coffee manufacture made Starbucks lessen its costs for transportation. In conclusion, the operations strategies adopted by Schultz have brought numerous changes to the Company in the last few years. Schultz concentrated on providing quality services to its customers, which enabled the Company to maintain its position as the most acknowledged and appreciated brand in the world. Further, the supply transformation plan introduced by Schultz enabled the Company to cut down costs while at th same time enhancing productivity and efficiency.Advertising Looking for essay on business economics? Let's see if we can help you! Get your first paper with 15% OFF Learn More References Boyer, K Verma, R 2010, Operations and supply chain management for the 21st century, Cengage Learning, London. Burks, M 2009, Starbucks, Santa Barbara, Greenwood Press. Jacobs, F R Chase, R B 2011, Operations and supply chain management, 13th edn, McGraw-Hill Irwin, New York. Michelli, J A 2007, The Starbucks experience: 5 principles for turning ordinary into extraordinary, McGraw Hill, New York. Paryani, K 2011, ‘Product quality, service reliability and management of operations at Starbucks’, International Journal of Engineering, Science and Technology, vol. 3 no.7, pp.1-14. Pearce, J P Robinson, R 2009, Strategic management: formulation, implementation and control, McGraw-Hill, New York. Russell, R S Taylor B W 2011, Operations management: creating value along the supply chain, 7th edn, John Wiley Sons, New Jersey. Stevenson, W J 2009, Operations management, 10th edn, McGraw-Hill Irwin, New York. This essay on Operations Strategies adopted by Schultz as CEO of Starbucks was written and submitted by user Anya Kirby to help you with your own studies. You are free to use it for research and reference purposes in order to write your own paper; however, you must cite it accordingly. You can donate your paper here.

GREEN FLUORESCENT PROTEIN (GFP) Essays

GREEN FLUORESCENT PROTEIN (GFP) Essays GREEN FLUORESCENT PROTEIN (GFP) Essay GREEN FLUORESCENT PROTEIN (GFP) Essay GREEN FLUORESCENT PROTEIN ( GFP ) MUTANTS WITH ALTERED FLUORESCENCE INTENSITY AND EMMISSION SPECTRA Introduction: Now-a-days GFP is making revolution in the field of scientific discipline by its applications and properties.GFP is a stable protein extracted from the exposure variety meats of the jellyfish Aequoria Victoria by Shimomura et Al in 1962. In 1992 the cloning of GFP has done. It is found in a assortment of cnidarians ( both Hydrozoa and Anthozoa ) and it emits light by using energy from the Ca2+ activated photoprotein aequorin [ 1 ] . Energy transportation and the emanation spectra of GFP can be affected by dimerization. Structure of GFP is cylindrical ?-can construction and has a chromophore located centrally. The chromophore is responsible for the fluorescence and the formation is independent of species but chiefly depends on O. GFP is a little protein and has been made up of 238 aminic acids. Deletion of any seven amino acids either from C-terminus or N-terminus may ensue in the loss of fluorescence. Amino acerb replacing is responsible for the alteration in colors of GFP. It has a molecular weight of 27 KDa and has an soaking up scope at 488 nanometer and an emanation scope at 509 nanometer. It can carry through high temperatures ( 65 ?c ) and basic PH scope of 6-12 [ 2 ] . Increase in PH consequences in the lessening of fluorescence. Increase in the fluorescence and exposure stableness can be achieved by individual point mutant at S65T. Fluorophore of the GFP is generated by utilizing auto-catalytic procedure of uninterrupted mechanisms. Visible excitement is one of the optical belongingss of GFP. Its derived functions are produced from the mutagenesis experiments like random and directed mutagenesis [ 3 ] . GFP is majorly used as a newsman in showing cistrons. Protein and chromophore folding besides constitutes as a major advantage of GFP. It can besides be used in protein merger by using recombinant DNA engineering. : Aim of this research is to analyse belongingss of GFP by cloning, mutants, look of proteins and purification. Aims of this research are to sub-clone GFP into a vector and mutants are carried out by assorted mutagenesis experiments followed by look of proteins and purification. Finally after purification belongingss are analyzed. Materials and methods: Initially DNA is isolated and GFPuv is sub-cloned into the pET28c vector from pET23 plasmid by speectrophotometric analysis. 5 µg of pET23GFPuv DNA is digested by utilizing NdeI and HindIII limitation enzymes. And the digests are analysed by utilizing Agarose gel cataphoresis. GFP fragment is extracted and purified utilizing QIA speedy gel extraction kit from QIAGEN and the cured DNA is estimated. Recombinant protein is expressed in E.coli by ligation and transmutation. To corroborate the presence of GFP in the pET28c plasmid, settlement PCR is used. Further mutagenesis experiments are carried out by planing oligonucleotide primers which will change the spectral belongingss of the protein. Complementary primers incorporating same mutants are generated. Mutagenic primers are prepared with a liquescent temperature of ? 78?C, length between 25 and 45 bases and primers longer than 45 bases are by and large used. Introduction and designation of mutants within GFPuv cistron: Mutants are created in the GFPuv insert by site-directed mutagenesis Site-directed mutagenesis: 5 µl 10 ten PCR buffer 5 µl 20 millimeter dNTP mixes 15 ng GFPuv-pET28c templet Deoxyribonucleic acid 125ng oligonucleotide primer F+ 125ng oligonucleotide primer R+ 2 µl 25mM MgSo4 32 µl unfertile H2O 1 µl KOD hot start polymerase ( 1U/ µl ) * All the above are added to 0.2ml PCR tubings and incubated in a PCR machine for 24 rhythms: 94?C 30s 94?C 30s 55?C 1min 68?C 4min 20s 68?C 10 min * Reaction is so kept on ice for 2 min and 1 µl ( 1U ) of Dpn1 is added and incubated for 60 min at 37?C Alliance of amino acid sequences is carried out utilizing: hypertext transfer protocol: //www.ebi.ac.uk/Tools/clustalw2/index.html Merchandise of site-directed mutagenesis ( pET28c DNA ) is transformed into XL-1 supercompetent cells. Transformed settlements are extracted utilizing QIAprep Mini prep kit Qiagen [ 5 ] . Concentration and pureness can be checked by utilizing Agarose gel cataphoresis. For this 5 µl of plasmid readying and 10U HindIII are digested at 37?C for 1h. Sequencing is so carried out by utilizing 10 µl of Deoxyribonucleic acid at a concentration of 50ng/ µl. E.coli BL21 ( DE3 ) cells are prepared and are transformed into the pET28cGFPuv plasmid for look Auto-induction method: Wild type protein ( GFPuv ) and the mutant protein are expressed in the look vector [ BL21 ( DE3 ) ] utilizing auto-induction method. For this transformed settlements are inoculated into 3ml of LB-1D + antibiotic media and incubated at 37?C at 300 RPM for 6 hour and O.D is taken. Inoculum is taken into the flask incorporating SB-5052 auto-induction medium along with antibiotic and incubated at 28?C at 300 RPM for 20 hour. Cultures are so cooled for 1 hour. Entire induced sample is prepared by taking 100 µl of chilling civilization and 900 µl of SB-5052 media. Cells are so pelletized by centrifugating it with both entire induced and non-induced samples and are resuspended in 100 µl of SDS-PAGE ( Na dodecyl sulfate ( SDS ) polyacrylamide gel cataphoresis ( PAGE ) ) sample buffer. 12 % of polyacrylamide gel is prepared and the Soluble and indissoluble samples are prepared by cell fractional process utilizing BUGBUSTER. For this 1 µl of DNAase1 is used along with reagents. Cell suspension is so centrifuged at 13000rpm for 20mins. Supernatant is so used as soluble sample and indissoluble is prepared by resuspending the pellet in 2ml binding buffer. SDS-PAGE buffer and binding buffer are added to the soluble and indissoluble fractions. At 95?C all samples are heated for 5 min. Gel is so loaded as: Molecular weight standard-5 µl Uninduced sample 5 µl Induced entire sample 5 µl Soluble sample 5 µl Gel has to run for 1 hour. And is transfered to a box of Coomassie blue discoloration. Western blotting: GFP protein presence can be verified utilizing western blotting technique. Protein samples are foremost seperated by SDS-PAGE and are transferred to the nitrocellulose membrane. GFP edge to nitrocellulose membrane is so visualised by incubating the smudge with His-probe which is linked to a HRP ( Equus caballus radish peroxidase ) enzyme ( HisprobeTM-HRP solution is diluted to 1:5000 ( 1 µl in 5ml ) ) . His-tag of GFP protein is bound to examine. Smudges are kept in TBST and investigations and therefore investigations are visualised by chemiluminescence and these are photographed by chemiluminescent reader. Ni-NTA chromatography: His labeled GFP can be purified by Ni-NTA ( nickel nitrilo triacetic acid ) chromatography method. In this, sample of soluble protein is loaded on column packed agarose rosin and the non-specific protein binding is removed by rinsing rosin with buffer and is eluted by high concentrated iminazole of elution buffer. After elution the purification of protein is done by SDS-PAGE and Coomassie staining. The concentration of the protein is measured by Bradford check. Fluorimetry and mass spectroscopy: Properties of GFPuv protein are analysed by Fluorimetry and mass spectrometry. Fluorimetry: In this wavelength and strength of a molecule at specific wavelength are measured utilizing fluorimeters. Perkin Elmer LS50B is the fluorimeter used to mensurate GFP. Quartz cuvettes are placed in a chamber to mensurate the concentration and strength. The parametric quantities set to mensurate GFP are: Excitement 440nm Emission 460-550nm Slit widths 4 and 4 Accretion 5 20 µg/ml of protein concentration is used. The emanation and excitor wavelengths are set at 509nm and 395nm. Mass spectroscopy: GFPuv belongingss and molecular mass can be analysed by mass spectrometry. The type of mass spectrometry used here is electron spray ionisation ( ESI ) . ESI is a type of atmospheric force per unit area ionization technique ( API ) which is used for biochemical analysis. JEOL HX110/HX110A equipped with electron ion beginning tandem mass spectrometers are used to analyze structural belongingss [ 7 ] . 1-10 pmol/ µl of protein concentration is used. Solvents used are: MeOH MeCN TFA During ionization sample is dissolved in a dissolver and is pumped through a steel capillary at a rate of 1 µl/min and electromotive force of 3 or 4KV is applied [ 8 ] . Ion current is amplified by the sensor and the information system will enter signals in the signifier of mass spectrum. Consequence: Site-directed mutagenesis: Primers used for site directed mutagenesis ( Mutant ) Forward primer: 5-CACTTGTCACTACTTTCTCTTGGGGTGTTCAATGCTTTTCC-3 Rearward primer: 5-GGAAAAGCATTGAACACCCCAAGAGAAAGTAGTGACAAGTG-3 Alliance of the amino acerb sequence of the mutation with the GFPuv amino acid sequence GFPuv MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL 60 mGFPuv MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL 60 ************************************************************ GFPuv VTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLV 120 mGFPuv VTTFSWGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLV 120 ***** : ****************************************************** Y66W GFPuv NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLAD 180 mGFPuv NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLAD 180 ************************************************************ GFPuv HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK- 238 mGFPuv HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK- 238 ********************************************************** Amino acerb permutation: Y66W Belongs to Class 5, indole in chromophore ( bluish green fluorescent proteins ) [ 6 ] eCFP CATATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGAT 60 GFP -ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGAT 57 ********************************************************* eCFP GGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATAC 120 GFP GGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATAC 117 ************************************************************ eCFP GGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACA 180 GFP GGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACA 177 ************************************************************ eCFP CTTGTCACTACTTTCTCTTGGGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAA 240 GFP CTTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCATATGAAA 237 ******************* ******************************** ****** Mutant eCFP CGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCT 300 GFP CGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCT 297 ************************************************************ eCFP TTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTT 360 GFP TTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTT 357 ************************************************************ eCFP GTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACAC 420 GFP GTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACAC 417 ************************************************************ eCFP AAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAAT 480 GFP AAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAAT 477 ************************************************************ eCFP GGAATCAAAGCT 492 GFP GGAATCAAAGCTAACTTCAAAATTCGCCACAACATTGAAGATGGATCCGTTCAACTAGCA 537 ************ eCFP GFP GACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCAT 597 eCFP GFP TACCTGTCGACACAATCTGCCCTTTCGAAAGATCCCAACGAAAAGCGTGACCACATGGTC 657 eCFP GFP CTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAATAA 717 SDS-PAGE: Coomassie staining gel of ( Sample 6 ) : Marker GFP protein ( soluble sample ) Western blotting ( Sample 11 ) : Induced entire sample GFP protein Ni-NTA chromatography: Fluorimetry: Mass spectroscopy: Wild-type: Mutant: Discussion: Site-directed mutagenesis: In the site-directed mutagenesis mutant is carried out at the right topographic point i.e. , at 197 and 198 topographic points. Tyrosine ( TAT ) is mutated to tryptophan ( TGG ) , Y W. During this mutant protein undergoes many alterations particularly in the fluorescence. GFP turns into CFP ( Cyan fluorescent protein ) hence the visible radiation emitted will non be precisely green. CFP will hold many curious characteristics like instead than individual excitement and emanation extremums it possess double hunching. Tag CFP possess some belongingss like: Structure monomer Molecular weight 27KDa Polypeptide length 239aa Fluorescence coloring material Cyan Maximal excitement 458nm Maximal emanation 480nm Excitation coefficient 37000M-1 cm-1 Pka 4.7 Quantum yield 0.57 Brightness 21.1 Brightness is produced by the quantum output and extinction coefficient. Double color visual image of the protein expressed is enabled by the CFP. This has led to the Fluorescence Resonance Energy Development ( FRET ) . SDS-PAGE: SDS-PAGE is carried out to divide proteins harmonizing to their cataphoretic mobility and experimental repetitions will ensue in the pureness appraisal of the protein. Four Wellss are loaded with samples and 2 and 4 Wellss show protein consequence and as 1 and 3 Wellss do nt incorporate protein they will be normal without any sets. Consequences shows that small sum of GFP has been observed in the indissoluble and big sum of protein has been observed in the soluble sample. Uninduced sample can non happen GFP. Western-blotting: Western-blot is performed to do certain the presence of protein. Histidine tagged investigation is added to corroborate the protein nowadays was GFP or non. pET28c plasmid contains T7 RNA polymerase booster sequence. But this booster is blocked by the represser. Hence lactose incorporating medium is required for E.coli growing. Because milk sugar is used as C beginning, glucose is converted into allolactose. This allolactose will adhere to repressor by unblocking booster, and expresses GFP. Hence presence of glucose will ensue in Lac-I and is binds to the operator. Band observed in the smudge is likely GFP and it has high degree of strength after initiation. And it is necessary to corroborate this by executing blotting technique utilizing His investigation to observe His labeled GFP. Sets are observed in the induced and soluble samples after executing western blotting corroborating the presence of GFP. Ni-NTA chromatography: Purification of GFP can be done by Ni-NTA chromatography. For a recombinant protein the amino acid adhering site with 6 or more His residues in a row acts as metal adhering site. So hexa-his sequence is called as His-tag. His-tag sequence is present in the N-terminal of the mark protein and is located in the booster part adjacently to the GFP cistron. During this procedure enzyme HRP is besides bound to the investigation. This HRP-probe will respond with luminal 4 peroxidase buffer which is further used for sublimating GFP by Ni-NTA chromatography. Purification by His-tagged GFP can be done by utilizing several methods like Ni2+-poly ( 2 acetomidoacrylic acid ) hydrogel. Supplanting of GFP can be done by adhering Ni to imidazole. This is chiefly because of high affinity of Ni towards imidazole compared to GFP.Distinctive sets are supposed to detect in the elute1, elute 2 and besides in the entire soluble fraction. Bands formed states the presence of the GFP mutation. Absence of the s ets states mutant absence. In the consequences sets are observed at the sum induced and the soluble samples which province the protein presence. Even little sums of sets are besides observed in the indissoluble sample. GFP protein produced in the induced entire sample is about at 27KDa. Little sets are observed in the indissoluble sample as it may be because of some drosss. Finally the GFP protein has been detected. Mentions: 1. Davenport D, Nichol JAC: Luminescence in Hydromedusae. Proceedings of the Royal Society, Series B 1955, 144:399-411 2. Ward. W. , Prentice, H. , Roth, A. Cody. C. and Reeeves.S.1982.Spectral disturbances of the Aequoria green fluorescent protein. Photochem. Photobiol. 35:803-808 3. Cormack, B. P. , Valdivia, R. H. , Falkow, S. ( 1996 ) . FACS-optimized mutations of the green fluorescent protein ( GFP ) . Gene, In imperativeness 4. Darelle Thomson, Greg Smith. ( 2001 ) .PCR-based plasmid vector building for coevals of recombinant viruses. Journal of Virological Methods 94, 7-14 5. Vogelstein, B. , and Gillespie, D. ( 1979 ) Preparative and analytical purification of Deoxyribonucleic acid from agarose. Proc. Natl. Acad. Sci. USA 76, 615-619. 6. HEIM, R. , PRASHER, D. C. A ; TSIEN, R. Y. 1994. Wavelength Mutations and Posttranslational Autoxidation of Green Fluorescent Protein. Proceedings of the National Academy of Sciences of the United States of America, 91, 12501-12504. 7. HARUKI NIWA, SATOSHI INOUYE et, al. , Chemical nature of the light emitter of the Aequorea green fluorescent protein. Vol. 93, pp. 13617-13622, November 1996. Proc. Natl. Acad. Sci. USA. 8. â€Å"Mass Spectroscopy: A Foundation Course† , K. Downard, Royal Society of Chemistry, UK, 2004.